A database of hormones and their receptors

Home

Hormone Peptide Non-peptide Search Search Browse Browse H-R Pair H-R Pair

Receptor Search Browse

Tools BLAST Domain Search Peptide Mapping Structure Search

Miscellaneous Online Submission HMRbase Information Supplementary Information Recent Information Help

Contact

Peptide Hormone

Search Result - 1

HMRbase accession number	10118
Swiss-prot Accession number	Q98849 (Sequence in FASTA format)
Description	Gonadotropin subunit beta-2 precursor (Gonadotropin beta-II chain)(GTH-II-beta) (Luteinizing hormone-like GTH).
Source organism	Carassius auratus (Goldfish)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Carassius.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Involved in gametogenesis and steroidogenesis
Protein Length	140 Amino acids
Molecular weight	15533
References	1  PubMed abstract 9073500 2   Sohn Y.C., Yoshiura Y., Suetake H., Kobayashi M., Aida K.; "Nucleotide sequence of gonadotropin II beta subunit gene ingoldfish."; Fish. Sci. 65:800-801(1999).
Domain Name	Cys_knot
Hormone Name	Gonadotropin subunit beta-2
Mature Hormone Sequence	SYLPPCEPVNETVAVEKEGCPKCLVLQTTICSGHCLTKEPVYKSPFSTVYQHVCTYRDVRYETVRLPDCPPGVDPHITYPVALSCDCSLCTMDTSDCTIESLQPDFCMSQREDFLVY
Position of mature hormone in Pre-Hormone protein	117 Residues from position (24-140)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 2

HMRbase accession number	10163
Swiss-prot Accession number	Q5KT10 (Sequence in FASTA format)
Description	Thyroliberin precursor [Contains: Prothyroliberin; Thyroliberin(Thyrotropin-releasing hormone) (TRH) (Thyrotropin-releasing factor)(TRF) (TSH-releasing factor) (Protirelin)].
Source organism	Carassius auratus (Goldfish)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Carassius.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the TRH family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Functions as a regulator of the biosynthesis of TSH in the anterior pituitary gland and as a neurotransmitter/ neuromodulator in the central and peripheral nervous systems
Protein Length	231 Amino acids
Molecular weight	26597
References	1  PubMed abstract 15707606
Domain Name	TRH
Hormone Name	Thyroliberin
Mature Hormone Sequence	QHP
Position of mature hormone in Pre-Hormone protein	3 Residues from position (70-72)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 3

HMRbase accession number	10223
Swiss-prot Accession number	Q98848 (Sequence in FASTA format)
Description	Gonadotropin subunit beta-1 precursor (Gonadotropin beta-I chain)(GTH-I-beta) (Follicle-stimulating hormone-like GTH).
Source organism	Carassius auratus (Goldfish)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Carassius.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Involved in gametogenesis and steroidogenesis
Protein Length	130 Amino acids
Molecular weight	14423
References	1  PubMed abstract 9073500 2  PubMed abstract 9831661 3  PubMed abstract 9073500 4  PubMed abstract 9831661
Domain Name	Cys_knot
Hormone Name	Gonadotropin subunit beta-1
Mature Hormone Sequence	GSECRSSCRLTNISITVESEECGSCITIDTTACAGLCKTQESVYRSPLMLSYQNTCNFREWTYETYEFKGCPARADSIFTYPVALSCECSKCNSDITDCGVLSQQTLGCNAH
Position of mature hormone in Pre-Hormone protein	112 Residues from position (19-130)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 4

HMRbase accession number	10227
Swiss-prot Accession number	P87495 (Sequence in FASTA format)
Description	Prolactin precursor (PRL).
Source organism	Carassius auratus (Goldfish)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Carassius.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the somatotropin/prolactin family.
Tissue Specificity	Pituitary gland
Post translational modification	N/A
Function	N/A
Protein Length	210 Amino acids
Molecular weight	23288
References	1  PubMed abstract 8652671
Domain Name	Hormone_1
Hormone Name	Prolactin
Mature Hormone Sequence	VGLNDLLERASQLSDKLHSLSTSLTNDLDSHFPPVGRVMMPRPSMCHTSSLQIPNDKDQALKVPEDELLSLARSLLLAWSDPLALLSSEASSLAHPERNTIDSKTKELQDNINSLGAGLEHVFNKMDSTSDNLSSLPFDINSLGQDKTSRLVNFHFLLSCFRRDSHKIDSFLKVLRCRAAKKRPEMC
Position of mature hormone in Pre-Hormone protein	187 Residues from position (24-210)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 5

HMRbase accession number	10359
Swiss-prot Accession number	Q9PTS1 (Sequence in FASTA format)
Description	Corticoliberin precursor (Corticotropin-releasing factor) (CRF)(Corticotropin-releasing hormone).
Source organism	Carassius auratus (Goldfish)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Carassius.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the sauvagine/corticotropin-releasing factor/urotensin I family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	This hormone from hypothalamus regulates the release of corticotropin from pituitary gland
Protein Length	162 Amino acids
Molecular weight	18418
References	1  PubMed abstract 10603283
Domain Name	CRF
Hormone Name	Corticoliberin
Mature Hormone Sequence	SEEPPISLDLTFHLLREVLEMARAEQMAQQAHSNRKMMEIF
Position of mature hormone in Pre-Hormone protein	41 Residues from position (120-160)
Receptor	Q49MT7   Detail in HMRbase    Q49MT8    Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 6

HMRbase accession number	10371
Swiss-prot Accession number	Q9YGH3 (Sequence in FASTA format)
Description	Somatostatin IB precursor [Contains: [Pro12]-somatostatin-24; [Pro2]-somatostatin-14].
Source organism	Carassius auratus (Goldfish)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Carassius.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the somatostatin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Somatostatin inhibits the release of somatotropin
Protein Length	111 Amino acids
Molecular weight	12558
References	1   Otto C.J., Lin X.-W., Peter R.E.; "Molecular cloning of cDNA encoding [Pro2]somatostatin-14 ingoldfish."; Submitted (SEP-1996) to the EMBL/GenBank/DDBJ databases.
Domain Name	Somatostatin
Hormone Name	[Pro12]-somatostatin-24
Mature Hormone Sequence	LSQLPQRDRKAPCKNFFWKTFTSC
Position of mature hormone in Pre-Hormone protein	24 Residues from position (88-111)
Receptor	Q7T2S8   Detail in HMRbase    Q7T2S9   Detail in HMRbase    Q8AXM7   Detail in HMRbase    Q8JID5   Detail in HMRbase    Q8QGQ4   Detail in HMRbase    Q9DGQ6   Detail in HMRbase    Q9PVF9   Detail in HMRbase    Q9PVG0    Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 7

HMRbase accession number	10372
Swiss-prot Accession number	Q9YGH3 (Sequence in FASTA format)
Description	Somatostatin IB precursor [Contains: [Pro12]-somatostatin-24; [Pro2]-somatostatin-14].
Source organism	Carassius auratus (Goldfish)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Carassius.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the somatostatin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Somatostatin inhibits the release of somatotropin
Protein Length	111 Amino acids
Molecular weight	12558
References	1   Otto C.J., Lin X.-W., Peter R.E.; "Molecular cloning of cDNA encoding [Pro2]somatostatin-14 ingoldfish."; Submitted (SEP-1996) to the EMBL/GenBank/DDBJ databases.
Domain Name	Somatostatin
Hormone Name	[Pro2]-somatostatin-14
Mature Hormone Sequence	APCKNFFWKTFTSC
Position of mature hormone in Pre-Hormone protein	14 Residues from position (98-111)
Receptor	Q7T2S8   Detail in HMRbase    Q7T2S9   Detail in HMRbase    Q8AXM7   Detail in HMRbase    Q8JID5   Detail in HMRbase    Q8QGQ4   Detail in HMRbase    Q9DGQ6   Detail in HMRbase    Q9PVF9   Detail in HMRbase    Q9PVG0    Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 8

HMRbase accession number	10373
Swiss-prot Accession number	Q9YGH4 (Sequence in FASTA format)
Description	Somatostatin-2 precursor (Somatostatin II) [Contains: [Tyr21,Gly24]-somatostatin-28; [Tyr7,Gly10]-somatostatin-14].
Source organism	Carassius auratus (Goldfish)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Carassius.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the somatostatin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Somatostatin inhibits the release of somatotropin
Protein Length	120 Amino acids
Molecular weight	13723
References	1  PubMed abstract 9827009 2   Otto C.J., Peter R.E.; "The expression of SRIF mRNA in the brain of goldfish."; Submitted (SEP-1997) to the EMBL/GenBank/DDBJ databases.
Domain Name	Somatostatin
Hormone Name	[Tyr21,Gly24]-somatostatin-28
Mature Hormone Sequence	SAESSNQLPTRVRKEGCKNFYWKGFTSC
Position of mature hormone in Pre-Hormone protein	28 Residues from position (93-120)
Receptor	Q7T2S8   Detail in HMRbase    Q7T2S9   Detail in HMRbase    Q8AXM7   Detail in HMRbase    Q8JID5   Detail in HMRbase    Q8QGQ4   Detail in HMRbase    Q9DGQ6   Detail in HMRbase    Q9PVF9   Detail in HMRbase    Q9PVG0    Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 9

HMRbase accession number	10374
Swiss-prot Accession number	Q9YGH4 (Sequence in FASTA format)
Description	Somatostatin-2 precursor (Somatostatin II) [Contains: [Tyr21,Gly24]-somatostatin-28; [Tyr7,Gly10]-somatostatin-14].
Source organism	Carassius auratus (Goldfish)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Carassius.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the somatostatin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Somatostatin inhibits the release of somatotropin
Protein Length	120 Amino acids
Molecular weight	13723
References	1  PubMed abstract 9827009 2   Otto C.J., Peter R.E.; "The expression of SRIF mRNA in the brain of goldfish."; Submitted (SEP-1997) to the EMBL/GenBank/DDBJ databases.
Domain Name	Somatostatin
Hormone Name	[Tyr7,Gly10]-somatostatin-14
Mature Hormone Sequence	EGCKNFYWKGFTSC
Position of mature hormone in Pre-Hormone protein	14 Residues from position (107-120)
Receptor	Q7T2S8   Detail in HMRbase    Q7T2S9   Detail in HMRbase    Q8AXM7   Detail in HMRbase    Q8JID5   Detail in HMRbase    Q8QGQ4   Detail in HMRbase    Q9DGQ6   Detail in HMRbase    Q9PVF9   Detail in HMRbase    Q9PVG0    Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 10

HMRbase accession number	10375
Swiss-prot Accession number	Q9YGH5 (Sequence in FASTA format)
Description	Somatostatin IA precursor [Contains: Somatostatin-26; Somatostatin-14].
Source organism	Carassius auratus (Goldfish)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Carassius.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the somatostatin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Somatostatin inhibits the release of somatotropin
Protein Length	114 Amino acids
Molecular weight	12575
References	1  PubMed abstract 9827009
Domain Name	Somatostatin
Hormone Name	Somatostatin-26
Mature Hormone Sequence	AAGPMLAPRERKAGCKNFFWKTFTSC
Position of mature hormone in Pre-Hormone protein	26 Residues from position (89-114)
Receptor	Q7T2S8   Detail in HMRbase    Q7T2S9   Detail in HMRbase    Q8AXM7   Detail in HMRbase    Q8JID5   Detail in HMRbase    Q8QGQ4   Detail in HMRbase    Q9DGQ6   Detail in HMRbase    Q9PVF9   Detail in HMRbase    Q9PVG0    Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 11

HMRbase accession number	10376
Swiss-prot Accession number	Q9YGH5 (Sequence in FASTA format)
Description	Somatostatin IA precursor [Contains: Somatostatin-26; Somatostatin-14].
Source organism	Carassius auratus (Goldfish)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Carassius.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the somatostatin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Somatostatin inhibits the release of somatotropin
Protein Length	114 Amino acids
Molecular weight	12575
References	1  PubMed abstract 9827009
Domain Name	Somatostatin
Hormone Name	Somatostatin-14
Mature Hormone Sequence	AGCKNFFWKTFTSC
Position of mature hormone in Pre-Hormone protein	14 Residues from position (101-114)
Receptor	Q7T2S8   Detail in HMRbase    Q7T2S9   Detail in HMRbase    Q8AXM7   Detail in HMRbase    Q8JID5   Detail in HMRbase    Q8QGQ4   Detail in HMRbase    Q9DGQ6   Detail in HMRbase    Q9PVF9   Detail in HMRbase    Q9PVG0    Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 12

HMRbase accession number	10712
Swiss-prot Accession number	O93359 (Sequence in FASTA format)
Description	Somatotropin-1 precursor (Somatotropin I) (Growth hormone I).
Source organism	Carassius auratus (Goldfish)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Carassius.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the somatotropin/prolactin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Growth hormone plays an important role in growth control and is involved in the regulation of several anabolic processes. Implicated as an osmoregulatory substance important for seawater adaptation
Protein Length	210 Amino acids
Molecular weight	23759
References	1  PubMed abstract 8651695
Domain Name	Hormone_1
Hormone Name	Somatotropin-1 (Somatotropin I) (Growth hormone I)
Mature Hormone Sequence	SDNQRLFNNAVIRVQHLHQLAAKMINDFEDSLLPEERRQLSKIFPLSFCNSDYIEAPTGKDETQKSSMLKLLRVSFRLIESWEFPSQTLSGTVSNSLTVGNPNQITEKLADLKMGISVLIQACLDGQPNMDDNDSLPLPFEEFYLTMGDNSLRESFRLLACFKKDMHKVETYLRVANCRRSLDSNCTL
Position of mature hormone in Pre-Hormone protein	188 Residues from position (23-210)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 13

HMRbase accession number	10716
Swiss-prot Accession number	O93360 (Sequence in FASTA format)
Description	Somatotropin-2 precursor (Somatotropin II) (Growth hormone II).
Source organism	Carassius auratus (Goldfish)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Carassius.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the somatotropin/prolactin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Growth hormone plays an important role in growth control and is involved in the regulation of several anabolic processes. Implicated as an osmoregulatory substance important for seawater adaptation
Protein Length	210 Amino acids
Molecular weight	23767
References	1  PubMed abstract 8651695
Domain Name	Hormone_1
Hormone Name	Somatotropin-2 (Somatotropin II) (Growth hormone II)
Mature Hormone Sequence	SDNQRLFNNAVIRVQHLHQLAAKMINDFEDSLLPEERRQLSKIFPLSFCNSDYIEAPTGKDETQKSSMLKLLRISFRLIESWEYPSQTLSGTVSNSLTAGNPNQITEKLADLKMGINVLIKGSLDGQPNIDDNDSLPLPFEDFYLTMGENNLRESFRLLACFKKDMHKVETYLRVANCRRSLDSNCTL
Position of mature hormone in Pre-Hormone protein	188 Residues from position (23-210)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 14

HMRbase accession number	11163
Swiss-prot Accession number	O93464 (Sequence in FASTA format)
Description	Cholecystokinins precursor (CCK8) [Contains: Cholecystokinin 8 (CCK8);Cholecystokinin 12 (CCK12); Cholecystokinin 26 (CCK26);Cholecystokinin 36 (CCK36); Cholecystokinin 69 (CCK69)].
Source organism	Carassius auratus (Goldfish)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Carassius.
Subcellular location	Secreted (Potential)
Developmental Stage	Expression in the brain shows variation throughout the seasonal sexual cycle; in the optic tectum-thalamus of females, expression levels are lower in early gonadal recrudescence (October) compared to other sexual stages. In males, expression is high in the olfactory bulbs in early gonadal recrudescence and low in the posterior brain in late gonadal recrudescence (January). Expression is higher in females than males in the telencephalon-preoptic region and posterior brain during late gonadal recrudescence, and in the olfactory bulbs and optic tectum-thalamus during the sexually mature (April), and post-spawning and sexually regressed (July) stages.
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	Expressed in the ovary, kidney, gill, gastrointestinal tract and pituitary. Differentially expressed in the brain in the optic tectum-thalamus, hypothalamus, telencephalon, olfactory bulb and tract, preoptic region and posterior brain region. Expression is strongest in the hypothalamus, where localization is to the posterior ventrolateral region. Expression in the brain is transiently increased 2 hours after feeding. Abundant in the sensory layers of the vagal lobe and along the border of the sensory region of the lobe and the deep fiber laye. Also present in the facial lobe and throughout the glossopharyngeal lobe
Post translational modification	The precursor is cleaved by enzymes to produce a number of active cholecystokinins (By similarity).
Function	This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut (By similarity). Induces the secretion of gonadotropin and growth hormone from the pituitary. Suppresses food intake and decreases the expression of preprosomatostatin genes in the forebrain
Protein Length	123 Amino acids
Molecular weight	13439
References	1  PubMed abstract 9493851 2  PubMed abstract 8262360 3  PubMed abstract 8092330 4  PubMed abstract 10640690 5  PubMed abstract 12124755 6  PubMed abstract 14751584 7  PubMed abstract 15256279
Domain Name	Gastrin
Hormone Name	Cholecystokinin
Mature Hormone Sequence	LSLPAVSEDGGQSDLGIVMEHTRHTRAAPSSGQLSLLSKAEDDEEPRSSLTELLARIISTKGTYRRSPSPKSKSMGNNHRIKDRDYLGWMDFGRRSAEEYEYSS
Position of mature hormone in Pre-Hormone protein	104 Residues from position (20-123)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 15

HMRbase accession number	11165
Swiss-prot Accession number	O93464 (Sequence in FASTA format)
Description	Cholecystokinins precursor (CCK8) [Contains: Cholecystokinin 8 (CCK8);Cholecystokinin 12 (CCK12); Cholecystokinin 26 (CCK26);Cholecystokinin 36 (CCK36); Cholecystokinin 69 (CCK69)].
Source organism	Carassius auratus (Goldfish)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Carassius.
Subcellular location	Secreted (Potential)
Developmental Stage	Expression in the brain shows variation throughout the seasonal sexual cycle; in the optic tectum-thalamus of females, expression levels are lower in early gonadal recrudescence (October) compared to other sexual stages. In males, expression is high in the olfactory bulbs in early gonadal recrudescence and low in the posterior brain in late gonadal recrudescence (January). Expression is higher in females than males in the telencephalon-preoptic region and posterior brain during late gonadal recrudescence, and in the olfactory bulbs and optic tectum-thalamus during the sexually mature (April), and post-spawning and sexually regressed (July) stages.
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	Expressed in the ovary, kidney, gill, gastrointestinal tract and pituitary. Differentially expressed in the brain in the optic tectum-thalamus, hypothalamus, telencephalon, olfactory bulb and tract, preoptic region and posterior brain region. Expression is strongest in the hypothalamus, where localization is to the posterior ventrolateral region. Expression in the brain is transiently increased 2 hours after feeding. Abundant in the sensory layers of the vagal lobe and along the border of the sensory region of the lobe and the deep fiber laye. Also present in the facial lobe and throughout the glossopharyngeal lobe
Post translational modification	The precursor is cleaved by enzymes to produce a number of active cholecystokinins (By similarity).
Function	This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut (By similarity). Induces the secretion of gonadotropin and growth hormone from the pituitary. Suppresses food intake and decreases the expression of preprosomatostatin genes in the forebrain
Protein Length	123 Amino acids
Molecular weight	13439
References	1  PubMed abstract 9493851 2  PubMed abstract 8262360 3  PubMed abstract 8092330 4  PubMed abstract 10640690 5  PubMed abstract 12124755 6  PubMed abstract 14751584 7  PubMed abstract 15256279
Domain Name	Gastrin
Hormone Name	Cholecystokinin 69
Mature Hormone Sequence	HTRAAPSSGQLSLLSKAEDDEEPRSSLTELLARIISTKGTYRRSPSPKSKSMGNNHRIKDRDYLGWMDF
Position of mature hormone in Pre-Hormone protein	69 Residues from position (43-111)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 16

HMRbase accession number	11166
Swiss-prot Accession number	O93464 (Sequence in FASTA format)
Description	Cholecystokinins precursor (CCK8) [Contains: Cholecystokinin 8 (CCK8);Cholecystokinin 12 (CCK12); Cholecystokinin 26 (CCK26);Cholecystokinin 36 (CCK36); Cholecystokinin 69 (CCK69)].
Source organism	Carassius auratus (Goldfish)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Carassius.
Subcellular location	Secreted (Potential)
Developmental Stage	Expression in the brain shows variation throughout the seasonal sexual cycle; in the optic tectum-thalamus of females, expression levels are lower in early gonadal recrudescence (October) compared to other sexual stages. In males, expression is high in the olfactory bulbs in early gonadal recrudescence and low in the posterior brain in late gonadal recrudescence (January). Expression is higher in females than males in the telencephalon-preoptic region and posterior brain during late gonadal recrudescence, and in the olfactory bulbs and optic tectum-thalamus during the sexually mature (April), and post-spawning and sexually regressed (July) stages.
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	Expressed in the ovary, kidney, gill, gastrointestinal tract and pituitary. Differentially expressed in the brain in the optic tectum-thalamus, hypothalamus, telencephalon, olfactory bulb and tract, preoptic region and posterior brain region. Expression is strongest in the hypothalamus, where localization is to the posterior ventrolateral region. Expression in the brain is transiently increased 2 hours after feeding. Abundant in the sensory layers of the vagal lobe and along the border of the sensory region of the lobe and the deep fiber laye. Also present in the facial lobe and throughout the glossopharyngeal lobe
Post translational modification	The precursor is cleaved by enzymes to produce a number of active cholecystokinins (By similarity).
Function	This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut (By similarity). Induces the secretion of gonadotropin and growth hormone from the pituitary. Suppresses food intake and decreases the expression of preprosomatostatin genes in the forebrain
Protein Length	123 Amino acids
Molecular weight	13439
References	1  PubMed abstract 9493851 2  PubMed abstract 8262360 3  PubMed abstract 8092330 4  PubMed abstract 10640690 5  PubMed abstract 12124755 6  PubMed abstract 14751584 7  PubMed abstract 15256279
Domain Name	Gastrin
Hormone Name	Cholecystokinin 36
Mature Hormone Sequence	IISTKGTYRRSPSPKSKSMGNNHRIKDRDYLGWMDF
Position of mature hormone in Pre-Hormone protein	36 Residues from position (76-111)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 17

HMRbase accession number	11167
Swiss-prot Accession number	O93464 (Sequence in FASTA format)
Description	Cholecystokinins precursor (CCK8) [Contains: Cholecystokinin 8 (CCK8);Cholecystokinin 12 (CCK12); Cholecystokinin 26 (CCK26);Cholecystokinin 36 (CCK36); Cholecystokinin 69 (CCK69)].
Source organism	Carassius auratus (Goldfish)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Carassius.
Subcellular location	Secreted (Potential)
Developmental Stage	Expression in the brain shows variation throughout the seasonal sexual cycle; in the optic tectum-thalamus of females, expression levels are lower in early gonadal recrudescence (October) compared to other sexual stages. In males, expression is high in the olfactory bulbs in early gonadal recrudescence and low in the posterior brain in late gonadal recrudescence (January). Expression is higher in females than males in the telencephalon-preoptic region and posterior brain during late gonadal recrudescence, and in the olfactory bulbs and optic tectum-thalamus during the sexually mature (April), and post-spawning and sexually regressed (July) stages.
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	Expressed in the ovary, kidney, gill, gastrointestinal tract and pituitary. Differentially expressed in the brain in the optic tectum-thalamus, hypothalamus, telencephalon, olfactory bulb and tract, preoptic region and posterior brain region. Expression is strongest in the hypothalamus, where localization is to the posterior ventrolateral region. Expression in the brain is transiently increased 2 hours after feeding. Abundant in the sensory layers of the vagal lobe and along the border of the sensory region of the lobe and the deep fiber laye. Also present in the facial lobe and throughout the glossopharyngeal lobe
Post translational modification	The precursor is cleaved by enzymes to produce a number of active cholecystokinins (By similarity).
Function	This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut (By similarity). Induces the secretion of gonadotropin and growth hormone from the pituitary. Suppresses food intake and decreases the expression of preprosomatostatin genes in the forebrain
Protein Length	123 Amino acids
Molecular weight	13439
References	1  PubMed abstract 9493851 2  PubMed abstract 8262360 3  PubMed abstract 8092330 4  PubMed abstract 10640690 5  PubMed abstract 12124755 6  PubMed abstract 14751584 7  PubMed abstract 15256279
Domain Name	Gastrin
Hormone Name	Cholecystokinin 26
Mature Hormone Sequence	SPSPKSKSMGNNHRIKDRDYLGWMDF
Position of mature hormone in Pre-Hormone protein	26 Residues from position (86-111)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 18

HMRbase accession number	11168
Swiss-prot Accession number	O93464 (Sequence in FASTA format)
Description	Cholecystokinins precursor (CCK8) [Contains: Cholecystokinin 8 (CCK8);Cholecystokinin 12 (CCK12); Cholecystokinin 26 (CCK26);Cholecystokinin 36 (CCK36); Cholecystokinin 69 (CCK69)].
Source organism	Carassius auratus (Goldfish)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Carassius.
Subcellular location	Secreted (Potential)
Developmental Stage	Expression in the brain shows variation throughout the seasonal sexual cycle; in the optic tectum-thalamus of females, expression levels are lower in early gonadal recrudescence (October) compared to other sexual stages. In males, expression is high in the olfactory bulbs in early gonadal recrudescence and low in the posterior brain in late gonadal recrudescence (January). Expression is higher in females than males in the telencephalon-preoptic region and posterior brain during late gonadal recrudescence, and in the olfactory bulbs and optic tectum-thalamus during the sexually mature (April), and post-spawning and sexually regressed (July) stages.
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	Expressed in the ovary, kidney, gill, gastrointestinal tract and pituitary. Differentially expressed in the brain in the optic tectum-thalamus, hypothalamus, telencephalon, olfactory bulb and tract, preoptic region and posterior brain region. Expression is strongest in the hypothalamus, where localization is to the posterior ventrolateral region. Expression in the brain is transiently increased 2 hours after feeding. Abundant in the sensory layers of the vagal lobe and along the border of the sensory region of the lobe and the deep fiber laye. Also present in the facial lobe and throughout the glossopharyngeal lobe
Post translational modification	The precursor is cleaved by enzymes to produce a number of active cholecystokinins (By similarity).
Function	This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut (By similarity). Induces the secretion of gonadotropin and growth hormone from the pituitary. Suppresses food intake and decreases the expression of preprosomatostatin genes in the forebrain
Protein Length	123 Amino acids
Molecular weight	13439
References	1  PubMed abstract 9493851 2  PubMed abstract 8262360 3  PubMed abstract 8092330 4  PubMed abstract 10640690 5  PubMed abstract 12124755 6  PubMed abstract 14751584 7  PubMed abstract 15256279
Domain Name	Gastrin
Hormone Name	Cholecystokinin 12
Mature Hormone Sequence	IKDRDYLGWMDF
Position of mature hormone in Pre-Hormone protein	12 Residues from position (100-111)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 19

HMRbase accession number	11169
Swiss-prot Accession number	O93464 (Sequence in FASTA format)
Description	Cholecystokinins precursor (CCK8) [Contains: Cholecystokinin 8 (CCK8);Cholecystokinin 12 (CCK12); Cholecystokinin 26 (CCK26);Cholecystokinin 36 (CCK36); Cholecystokinin 69 (CCK69)].
Source organism	Carassius auratus (Goldfish)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Carassius.
Subcellular location	Secreted (Potential)
Developmental Stage	Expression in the brain shows variation throughout the seasonal sexual cycle; in the optic tectum-thalamus of females, expression levels are lower in early gonadal recrudescence (October) compared to other sexual stages. In males, expression is high in the olfactory bulbs in early gonadal recrudescence and low in the posterior brain in late gonadal recrudescence (January). Expression is higher in females than males in the telencephalon-preoptic region and posterior brain during late gonadal recrudescence, and in the olfactory bulbs and optic tectum-thalamus during the sexually mature (April), and post-spawning and sexually regressed (July) stages.
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	Expressed in the ovary, kidney, gill, gastrointestinal tract and pituitary. Differentially expressed in the brain in the optic tectum-thalamus, hypothalamus, telencephalon, olfactory bulb and tract, preoptic region and posterior brain region. Expression is strongest in the hypothalamus, where localization is to the posterior ventrolateral region. Expression in the brain is transiently increased 2 hours after feeding. Abundant in the sensory layers of the vagal lobe and along the border of the sensory region of the lobe and the deep fiber laye. Also present in the facial lobe and throughout the glossopharyngeal lobe
Post translational modification	The precursor is cleaved by enzymes to produce a number of active cholecystokinins (By similarity).
Function	This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut (By similarity). Induces the secretion of gonadotropin and growth hormone from the pituitary. Suppresses food intake and decreases the expression of preprosomatostatin genes in the forebrain
Protein Length	123 Amino acids
Molecular weight	13439
References	1  PubMed abstract 9493851 2  PubMed abstract 8262360 3  PubMed abstract 8092330 4  PubMed abstract 10640690 5  PubMed abstract 12124755 6  PubMed abstract 14751584 7  PubMed abstract 15256279
Domain Name	Gastrin
Hormone Name	Cholecystokinin 8
Mature Hormone Sequence	DYLGWMDF
Position of mature hormone in Pre-Hormone protein	8 Residues from position (104-111)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 20

HMRbase accession number	11234
Swiss-prot Accession number	O42471 (Sequence in FASTA format)
Description	Progonadoliberin IIB precursor [Contains: Gonadoliberin II(Luteinizing hormone-releasing hormone II) (LH-RH II) (Gonadotropin-releasing hormone II) (GnRH II) (Luliberin II); GnRH-associatedpeptide IIB].
Source organism	Carassius auratus (Goldfish)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Carassius.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the GnRH family.
Tissue Specificity	Olfactory bulbs, hypothalamus and telencephalon, midbrain and posterior brain areas
Post translational modification	N/A
Function	Stimulates the secretion of gonadotropins
Protein Length	86 Amino acids
Molecular weight	9917
References	1  PubMed abstract 9289408
Domain Name	N/A
Hormone Name	Gonadoliberin II
Mature Hormone Sequence	QHWSHGWYPG
Position of mature hormone in Pre-Hormone protein	10 Residues from position (25-34)
Receptor	Q9YGN8   Detail in HMRbase    Q9YGN9    Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 21

HMRbase accession number	11474
Swiss-prot Accession number	P51917 (Sequence in FASTA format)
Description	Progonadoliberin-3 precursor (Progonadoliberin III) [Contains:Gonadoliberin-3 (Gonadoliberin III) (Luteinizing hormone-releasinghormone III) (LH-RH III) (Gonadotropin-releasing hormone III) (GnRHIII) (Luliberin III); GnRH-associated peptide 3 (GnRH-associatedpeptide III)].
Source organism	Carassius auratus (Goldfish)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Carassius.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the GnRH family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Stimulates the secretion of gonadotropins
Protein Length	94 Amino acids
Molecular weight	10511
References	1  PubMed abstract 8729938
Domain Name	N/A
Hormone Name	Gonadoliberin-3
Mature Hormone Sequence	QHWSYGWLPG
Position of mature hormone in Pre-Hormone protein	10 Residues from position (24-33)
Receptor	Q9YGN8   Detail in HMRbase    Q9YGN9    Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 22

HMRbase accession number	11475
Swiss-prot Accession number	P51924 (Sequence in FASTA format)
Description	Progonadoliberin IIA precursor [Contains: Gonadoliberin II(Luteinizing hormone-releasing hormone II) (LH-RH II) (Gonadotropin-releasing hormone II) (GnRH II) (Luliberin II); GnRH-associatedpeptide IIA].
Source organism	Carassius auratus (Goldfish)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Carassius.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the GnRH family.
Tissue Specificity	Olfactory bulbs, hypothalamus and telencephalon, midbrain and posterior brain areas
Post translational modification	N/A
Function	Stimulates the secretion of gonadotropins
Protein Length	86 Amino acids
Molecular weight	9770
References	1  PubMed abstract 8729938 2  PubMed abstract 9289408
Domain Name	N/A
Hormone Name	Gonadoliberin II
Mature Hormone Sequence	QHWSHGWYPG
Position of mature hormone in Pre-Hormone protein	10 Residues from position (25-34)
Receptor	Q9YGN8   Detail in HMRbase    Q9YGN9    Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 23

HMRbase accession number	11498
Swiss-prot Accession number	P79695 (Sequence in FASTA format)
Description	Glucagon precursor [Contains: Glicentin-related polypeptide (GRPP);Glucagon; Glucagon-like peptide].
Source organism	Carassius auratus (Goldfish)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Carassius.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glucagon family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Glucagon plays a key role in glucose metabolism and homeostasis. Regulates blood glucose by increasing gluconeogenesis and decreasing glycolysis
Protein Length	121 Amino acids
Molecular weight	13527
References	1   DOI=10.1023/A:1007793705131; Yuen T.T.H., Mok P.Y., Chow B.K.C.; "Molecular cloning of a cDNA encoding proglucagon from goldfish,Carassius auratus."; Fish Physiol. Biochem. 17:223-230(1997).
Domain Name	Hormone_2
Hormone Name	Glucagon
Mature Hormone Sequence	HSEGTFSNDYSKYLETRRAQDFVEWLMNS
Position of mature hormone in Pre-Hormone protein	29 Residues from position (50-78)
Receptor	Q5EFJ9    Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 24

HMRbase accession number	11499
Swiss-prot Accession number	P79695 (Sequence in FASTA format)
Description	Glucagon precursor [Contains: Glicentin-related polypeptide (GRPP);Glucagon; Glucagon-like peptide].
Source organism	Carassius auratus (Goldfish)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Carassius.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glucagon family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	N/A
Protein Length	121 Amino acids
Molecular weight	13527
References	1   DOI=10.1023/A:1007793705131; Yuen T.T.H., Mok P.Y., Chow B.K.C.; "Molecular cloning of a cDNA encoding proglucagon from goldfish,Carassius auratus."; Fish Physiol. Biochem. 17:223-230(1997).
Domain Name	Hormone_2
Hormone Name	Glucagon-like peptide
Mature Hormone Sequence	HAEGTYTSDISSFLRDQAAQNFVAWLKSGQPKQE
Position of mature hormone in Pre-Hormone protein	34 Residues from position (88-121)
Receptor	Q5EFJ9    Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments